| IED ID | IndEnz0002009214 |
| Enzyme Type ID | protease009214 |
| Protein Name |
HTH-type transcriptional regulator MgrA Regulator of autolytic activity |
| Gene Name | mgrA mgr |
| Organism | Staphylococcus aureus |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus |
| Enzyme Sequence | MSDQHNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAFDETKEK |
| Enzyme Length | 147 |
| Uniprot Accession Number | P0C1S0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 55..78; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00345 |
| EC Number | |
| Enzyme Function | FUNCTION: Regulatory protein involved in autolytic activity, multidrug resistance and virulence (By similarity). Negatively controls spa (surface protein A) transcription. Activates type 8 capsular polysaccharide (cap8) and nuclease (nuc) biosynthesis. Represses coagulase and protease production. {ECO:0000250, ECO:0000269|PubMed:12813062}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); DNA binding (1); Domain (1); Helix (8); Initiator methionine (1); Turn (1) |
| Keywords | 3D-structure;Activator;Cytoplasm;DNA-binding;Repressor;Transcription;Transcription regulation;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 2BV6; |
| Mapped Pubmed ID | 16980961; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,089 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |