| IED ID | IndEnz0002009237 |
| Enzyme Type ID | protease009237 |
| Protein Name |
OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 4 OTU domain-containing protein 4 EC 3.4.19.12 Deubiquitinating enzyme OTU4 |
| Gene Name | OTU4 At3g57810 T10K17.20 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MMICYSPITTCSRNAISIKRHLGSRLYGVVAHGSSKFSCYSLLSGLSRRHYTGFRVSVSNRPSSWHDKGLFGSVLINRPTVAPKEKLEVSFLSPEANMKCSKIESNMRNLYCYSRFAYTGVIVSLLVCYSSTSQSAYADSSRDKDANNVHHHSSDGKFHNGKRVYTDYSIIGIPGDGRCLFRSVAHGFCLRSGKLAPGEKMQRELADELRTRVADEFIQRRQETEWFVEGDFDTYVRQIRDPHVWGGEPELFMASHVLQMPITVYMKDDKAGGLISIAEYGQEYGKDDPIRVLYHGFGHYDALLLHESKASIPKSKL |
| Enzyme Length | 317 |
| Uniprot Accession Number | Q8LBZ4 |
| Absorption | |
| Active Site | ACT_SITE 176; /evidence=ECO:0000255; ACT_SITE 179; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q96G74; ACT_SITE 299; /evidence=ECO:0000250|UniProtKB:Q96G74 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000269|PubMed:24659992}; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation (PubMed:24659992). Cysteine protease with a preference for 'Lys-63' over 'Lys-48'-linked over 'Met-1' ubiquitin (UB) tetramers (e.g. Ub3 and Ub4) as substrates (PubMed:24659992). Cleaves also RUB-GST fusion (PubMed:24659992). {ECO:0000269|PubMed:24659992}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7. {ECO:0000269|PubMed:24659992}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Alternative sequence (7); Chain (1); Domain (1); Erroneous gene model prediction (1); Frameshift (3); Mutagenesis (1); Sequence conflict (4) |
| Keywords | Alternative splicing;Cytoplasm;Hydrolase;Reference proteome;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305}. Note=Prediction of a peroxisomal location. {ECO:0000269|PubMed:15333753}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12093376; 14576160; 17932292; 21365755; |
| Motif | |
| Gene Encoded By | |
| Mass | 35,774 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |