IED ID | IndEnz0002009243 |
Enzyme Type ID | protease009243 |
Protein Name |
OTU domain-containing protein 6A EC 3.4.19.12 Hin-6 protease |
Gene Name | Otud6a Hin6 |
Organism | Mus musculus (Mouse) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
Enzyme Sequence | MSDTEQELQRVIRRHYREKRELQAHIQTLKASVPKNDKGRRKQMLADISRLEAEMEQRHKQELEKFGENPDSSVDSVTADLEKMNLENMPPRPPKAQKRRDRRAHQERRHQERMPAAQAEQLAANRREEEEKVAAILGAKNLEMKTIPADGHCMYRAIQDQLVFSVTIESLRYRTAYYMRKHIDDFLPFFTEPEAGNFYTREDFLRYCDDIVHNASWGGQLELRALSHVLQTPIEVVQANSPTIVIGEEYTRKPVTLVYLHYACDFGEHYNSVKPIEVAGAFGGMAPRLF |
Enzyme Length | 290 |
Uniprot Accession Number | Q6IE21 |
Absorption | |
Active Site | ACT_SITE 150; /evidence=ECO:0000250; ACT_SITE 153; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 269; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; |
DNA Binding | |
EC Number | 3.4.19.12 |
Enzyme Function | FUNCTION: Deubiquitinating enzyme that hydrolyzes 'Lys-27'-, 'Lys-29'- and 'Lys-33'-linked polyubiquitin chains. Also able to hydrolyze 'Lys-11'-linked ubiquitin chains (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Chain (1); Compositional bias (1); Domain (1); Region (4) |
Keywords | Hydrolase;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 21267068; 27626380; |
Motif | |
Gene Encoded By | |
Mass | 33,738 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |