| IED ID | IndEnz0002009256 |
| Enzyme Type ID | protease009256 |
| Protein Name |
OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 9 OTU domain-containing protein 9 EC 3.4.19.12 Deubiquitinating enzyme OTU9 |
| Gene Name | OTU9 At5g04250 F21E1.170 T19N18.9 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MGYEPDPDALRWGLHDLEVCTLTNAGSCSSVTRYESGGGGTQGYVREGYNQPVTGYVDNDAVIAQFYQDELSRVARAEASGINSLSPTSVVAQDWPHPHQGQENQGEAIDITQESDILHNHNGNMEDKNVARIRFEGGQSSPSRDDDSVCSVEIEEESWSEVGKRLNQMIPIAHVPKINGELPSEDEQISDHERLFQRLQLYGLVENKIEGDGNCQFRSLSDQLYRSPEHHNFVREQVVNQLAYNREIYEGYVPMAYNDYLKAMKRNGEWGDHVTLQAAADLFGVRMFVITSFKDTCYIEILPHFQKSNRLICLSFWAEVHYNSIYPEGELPIPEGKKKKKYWVF |
| Enzyme Length | 345 |
| Uniprot Accession Number | Q8LBW2 |
| Absorption | |
| Active Site | ACT_SITE 212; /evidence=ECO:0000255; ACT_SITE 215; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q96G74; ACT_SITE 321; /evidence=ECO:0000250|UniProtKB:Q96G74 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000269|PubMed:24659992}; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation (Probable). Cysteine protease with a preference for 'Lys-63' and 'Lys-48' -linked ubiquitin (UB) tetramers as substrates (PubMed:24659992). Cleaves also RUB-GST fusion (PubMed:24659992). {ECO:0000269|PubMed:24659992, ECO:0000305|PubMed:24659992}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7. {ECO:0000269|PubMed:24659992}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Domain (1); Erroneous gene model prediction (1) |
| Keywords | Hydrolase;Reference proteome;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 17304219; 18775970; 23148892; |
| Motif | |
| Gene Encoded By | |
| Mass | 39,231 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |