| IED ID | IndEnz0002009264 |
| Enzyme Type ID | protease009264 |
| Protein Name |
Ubiquitin thioesterase otubain-like EC 3.4.19.12 Ubiquitin-specific-processing protease otubain-like Deubiquitinating enzyme otubain-like |
| Gene Name | CG4968 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MEPFTHNDGNRDELIIQQKRDIEKEISDTTPLVSEQLPLTCLYAEYSGDEIFTAKIQDLSKKYKFIRRTRPDGNCFFRAFAYSYLEYLISNTSAYQEFKKLAEESKEKLVQLGFPSFTLEDFHETFMEVIQRVSPDNAGGHSTVQDELHKIFNEQGYSDYVVVYLRLITSGKLQEEADFYQNFIEGDLTIEAFRHLEVEPMYKESDHIHIIALCTALGAGVRVEYLDRGEGGTVKAHDFPEGSEPRIYLIYRPGHYDILYPN |
| Enzyme Length | 262 |
| Uniprot Accession Number | Q9VL00 |
| Absorption | |
| Active Site | ACT_SITE 72; /evidence=ECO:0000250|UniProtKB:Q96DC9; ACT_SITE 75; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q96DC9; ACT_SITE 255; /evidence=ECO:0000250|UniProtKB:Q96DC9 |
| Activity Regulation | |
| Binding Site | BINDING 168; /note=Substrate; via carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:Q5VVQ6 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:Q96DC9}; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Possible hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Binding site (1); Chain (1); Domain (1) |
| Keywords | Hydrolase;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14605208; 17368005; 20220848; 20371351; 21074052; 22884528; 22937016; 23071443; 23275879; 23899565; 24362437; 25954029; 26870755; 27172210; 27513559; 27527793; 29050293; 30446899; 31722958; 31794428; 33988679; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,372 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |