| IED ID | IndEnz0002009296 |
| Enzyme Type ID | protease009296 |
| Protein Name |
Ovalbumin Egg albumin |
| Gene Name | SERPINB14 |
| Organism | Meleagris gallopavo (Wild turkey) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Meleagridinae Meleagris Meleagris gallopavo (Wild turkey) |
| Enzyme Sequence | MGSIGAVSMEFCFDVFKELKVHHANENIFYSPFTIISALAMVYLGAKDSTRTQINKVVRFDKLPGFGDSVEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEETYPILPEYLQCVKELYRGGLESINFQTAADQARGLINSWVESQTNGMIKNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAIPFRVTEQESKPVQMMYQIGLFKVASMASEKMKILELPFASGTMSMWVLLPDEVSGLEQLETTISFEKMTEWISSNIMEERRIKVYLPRMKMEEKYNLTSVLMAMGITDLFSSSANLSGISSAGSLKISQAAHAAYAEIYEAGREVIGSAEAGADATSVSEEFRVDHPFLYCIKHNLTNSILFFGRCISP |
| Enzyme Length | 386 |
| Uniprot Accession Number | O73860 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Storage protein of egg white. Lack protease inhibitory activity (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Glycosylation (3); Initiator methionine (1); Modified residue (3); Signal peptide (1); Site (1) |
| Keywords | Acetylation;Direct protein sequencing;Disulfide bond;Glycoprotein;Phosphoprotein;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | MOD_RES 2; /note=N-acetylglycine; /evidence=ECO:0000250; MOD_RES 69; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:6783411; MOD_RES 345; /note=Phosphoserine; /evidence=ECO:0000269|PubMed:6783411 |
| Post Translational Modification | PTM: The signal sequence is not cleaved. The functional signal for membrane translocation of ovalbumin becomes accessible when the nascent chain is 50 to 60 residues long. The hydrophobic sequence which lies between residues 27 and 43 folds back on the preceding residues to form an amphipathic hairpin structure which is the signal element recognized by the membrane (By similarity). {ECO:0000250}. |
| Signal Peptide | SIGNAL 22..48; /note=Not cleaved; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 42,988 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |