| IED ID | IndEnz0002009337 |
| Enzyme Type ID | protease009337 |
| Protein Name |
Probable capsid maturation protease EC 3.4.-.- Gene product 5 gp5 |
| Gene Name | |
| Organism | Lactococcus phage SK1 (Lactococcus lactis bacteriophage SK1) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Siphoviridae (phages with long non-contractile tails) Skunavirus Lactococcus phage SK1 (Lactococcus lactis bacteriophage SK1) |
| Enzyme Sequence | MKLITNSAEIKVTENEDGSKSFQGIGSEVGVENRNGIVLTPNCIEFARERYPLLYEHGAGSSEVIGDAKVYYDLASNKYLTDFTLYDNAPNINKAVENGAFDSLSIAYYITDYEFNENDALVVNKAQFKEISLVSVPADPNAKFIQNALGEELTEERNKIIESRNALKEIEDIKKKYE |
| Enzyme Length | 178 |
| Uniprot Accession Number | O21873 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Probable capsid maturation protease. {ECO:0000250|UniProtKB:D3WAC4}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Coiled coil (1) |
| Keywords | Coiled coil;Hydrolase;Protease;Reference proteome;Viral capsid assembly;Viral capsid maturation;Viral release from host cell |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,947 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |