| IED ID | IndEnz0002009338 |
| Enzyme Type ID | protease009338 |
| Protein Name |
Serine protease 41 EC 3.4.21.- Testis serine protease 1 TESSP-1 |
| Gene Name | Prss41 Tessp1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MGIQGPVLLLLLLCVMLGKPGSREESQAADLKSTDIKLLSMPCGRRNDTRSRIVGGIESMQGRWPWQASLRLKKSHRCGGSLLSRRWVLTAAHCFRKYLDPEKWTVQLGQLTSKPSYWNRKAYSGRYRVKDIIVNSEDKLKSHDLALLRLASSVTYNKDIQPVCVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLHHLITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSWGIGCGRPNLPGIYTNVSHYYNWIETMMILNGAVRRDLALPLLSITLLQAPWLLRPT |
| Enzyme Length | 322 |
| Uniprot Accession Number | Q920S2 |
| Absorption | |
| Active Site | ACT_SITE 93; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 144; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 246; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Alternative sequence (2); Chain (1); Disulfide bond (4); Domain (1); Glycosylation (1); Lipidation (1); Propeptide (2); Sequence conflict (1); Signal peptide (1) |
| Keywords | Alternative splicing;Cell membrane;Disulfide bond;GPI-anchor;Glycoprotein;Hydrolase;Lipoprotein;Membrane;Protease;Reference proteome;Serine protease;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:15515062, ECO:0000269|PubMed:19798924}; Lipid-anchor, GPI-anchor {ECO:0000269|PubMed:15515062, ECO:0000269|PubMed:19798924}. Note=Localized in the plasma membrane of spermatogonia. Localized in intracellular compartment in spermatocytes, probably in the Golgi apparatus. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated. {ECO:0000269|PubMed:15515062}. |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 14583634; 16143303; 21677750; 24129193; |
| Motif | |
| Gene Encoded By | |
| Mass | 36,218 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |