Detail Information for IndEnz0002009350
IED ID IndEnz0002009350
Enzyme Type ID protease009350
Protein Name Proteasome subunit beta type-9
EC 3.4.25.1
Low molecular mass protein 2
Gene Name psmb9-a lmp2-a; psmb9-b lmp2-b
Organism Salmo salar (Atlantic salmon)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Protacanthopterygii Salmoniformes (salmons and trouts) Salmonidae (salmonids) Salmoninae (trouts salmons & chars) Salmo Salmo salar (Atlantic salmon)
Enzyme Sequence MLEESSEPGWLSEEVKTGTTIIAIEFDGGVVLGSDSRVSAGETVVNRVMNKLSLLHDKIYCALSGSAADAQTIAEMVNYQLDVHSIEVGEDPQVRSAATLVKNISYKYKEELSAHLIVAGWDKRGGGQVYVTLNGLLSRQPFAVGGSGSAYVYGFVDAEYRKAMSKEDCQQFVVNTLSLAMSRDGSSGGVAYLVTIDEKGAEEKCILGNELPTFYDQ
Enzyme Length 217
Uniprot Accession Number Q9DD33
Absorption
Active Site ACT_SITE 19; /note=Nucleophile; /evidence=ECO:0000250
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Cleavage of peptide bonds with very broad specificity.; EC=3.4.25.1;
DNA Binding
EC Number 3.4.25.1
Enzyme Function FUNCTION: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides (By similarity). {ECO:0000250}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (1); Chain (1); Propeptide (1); Site (1)
Keywords Cytoplasm;Hydrolase;Immunity;Nucleus;Protease;Proteasome;Reference proteome;Threonine protease;Zymogen
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|PROSITE-ProRule:PRU00809}. Nucleus {ECO:0000250}.
Modified Residue
Post Translational Modification PTM: Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity. {ECO:0000250|UniProtKB:O35955}.
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 23,392
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda