| IED ID | IndEnz0002009366 |
| Enzyme Type ID | protease009366 |
| Protein Name |
Signal peptidase complex catalytic subunit sec11 EC 3.4.21.89 |
| Gene Name | sec11 DDB_G0276359 |
| Organism | Dictyostelium discoideum (Slime mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia (dictyostelid cellular slime molds) Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) |
| Enzyme Sequence | MNDIISKINPFSSIPKHQIAQQIVNFGLIVATALMIWKGLMIFSGSESPIVVVLSGSMIPAFFRGDLLYLNMEDGPFRVGEIVVFKIEGKEIPIVHRILQIHEKEDGLYDIRTKGDNNNVDDVGLYSPGQRWLSRDHIIGRAKGFLPSVGMVTIVMHDYPQLKFFLVFVLAVFVLSTRE |
| Enzyme Length | 179 |
| Uniprot Accession Number | Q86JD4 |
| Absorption | |
| Active Site | ACT_SITE 57; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P67812; ACT_SITE 96; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P67812; ACT_SITE 122; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P67812 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins.; EC=3.4.21.89; Evidence={ECO:0000250|UniProtKB:P67812}; |
| DNA Binding | |
| EC Number | 3.4.21.89 |
| Enzyme Function | FUNCTION: Catalytic component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Specifically cleaves N-terminal signal peptides that contain a hydrophobic alpha-helix (h-region) shorter than 18-20 amino acids. {ECO:0000250|UniProtKB:P67812}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Region (1); Topological domain (2); Transmembrane (1) |
| Keywords | Endoplasmic reticulum;Hydrolase;Membrane;Protease;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P67811}; Single-pass type II membrane protein {ECO:0000250|UniProtKB:P67811}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 22120990; |
| Motif | |
| Gene Encoded By | |
| Mass | 20,145 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |