| IED ID | IndEnz0002009388 |
| Enzyme Type ID | protease009388 |
| Protein Name |
Sporulation sigma-E factor-processing peptidase EC 3.4.23.- Membrane-associated aspartic protease Stage II sporulation protein GA |
| Gene Name | spoIIGA BMQ_4271 |
| Organism | Priestia megaterium (strain ATCC 12872 / QMB1551) (Bacillus megaterium) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Priestia Priestia megaterium (Bacillus megaterium) Priestia megaterium (strain ATCC 12872 / QMB1551) (Bacillus megaterium) |
| Enzyme Sequence | MPIYLDLIWMLNFGLDTILLMLCAVVLKRNYKWWRLLLGGFIGSLIVLLMFTPFSHLMVHPAIKILFSFFMVLMTFGYKRLRFFFENLLTFYFATFVVGGGLMGVHFLFQDQFLVLNQMVDTKSPQFGDPISWIFVLIGFPLLSYFSKTRVDDLRIKNITFDQLVDVEIILNEQTLSMKGLIDSGNQLVDPLTKTPVMIVTADSLKEILPEGLMELSKNVQSFSHSEDIDQEWYSKVRFVPYRSVGQANQLLLALKPDMVRLVHQSNTIEVTKVLVGISHTTLSVEKQYECIVHPKLIVIGEVSSAS |
| Enzyme Length | 307 |
| Uniprot Accession Number | D5DQW6 |
| Absorption | |
| Active Site | ACT_SITE 183; /evidence=ECO:0000250|UniProtKB:P13801 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.23.- |
| Enzyme Function | FUNCTION: Probable aspartic protease that is responsible for the proteolytic cleavage of the RNA polymerase sigma E factor (SigE/spoIIGB) to yield the active peptide in the mother cell during sporulation. Responds to a signal from the forespore that is triggered by the extracellular signal protein SpoIIR (By similarity). {ECO:0000250|UniProtKB:P13801}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Erroneous initiation (1); Sequence conflict (1); Transmembrane (5) |
| Keywords | Aspartyl protease;Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Sporulation;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:9663680}; Multi-pass membrane protein {ECO:0000269|PubMed:9663680}. Note=Localized to the sporulation septum. Early in sporulating cells localized in an annulus at the septal periphery and later localized uniformly throughout the septa. {ECO:0000269|PubMed:9663680}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,146 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |