| IED ID | IndEnz0002009395 |
| Enzyme Type ID | protease009395 |
| Protein Name |
Protein SOM1, mitochondrial Mitochondrial inner membrane protease subunit SOM1 |
| Gene Name | SOM1 YEL059C-A YEL059BC |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDKSATNYEVTDTYTNS |
| Enzyme Length | 74 |
| Uniprot Accession Number | Q05676 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Non-catalytic component of the mitochondrial inner membrane peptidase (IMP) complex. IMP catalyzes the removal of signal peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. SOM1 facilitates cleavage of a subset of IMP substrates. {ECO:0000269|PubMed:15254042, ECO:0000269|PubMed:8879245}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Transit peptide (1) |
| Keywords | Membrane;Mitochondrion;Mitochondrion inner membrane;Reference proteome;Transit peptide |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10821182; 11004448; 11943460; 11996120; 15118906; 15905047; 16510898; 17445721; 19703468; 19751518; 21958598; 23276920; 23994494; 25435547; 27693354; 9604886; |
| Motif | |
| Gene Encoded By | |
| Mass | 8,416 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |