| IED ID | IndEnz0002009397 |
| Enzyme Type ID | protease009397 |
| Protein Name |
Antileukoproteinase ALP Secretory leukocyte protease inhibitor |
| Gene Name | Slpi |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM |
| Enzyme Length | 131 |
| Uniprot Accession Number | P97430 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G (PubMed:9126337). Modulates the innate immune response after bacterial infection (PubMed:12615907). Contributes to regulate the inflammatory and immune responses to the intracellular parasite L.major (PubMed:25030421). Down-regulates responses to bacterial lipopolysaccharide (LPS) (PubMed:9039268, PubMed:12615907, PubMed:25030421). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses (PubMed:11017147, PubMed:12615907). Has antimicrobial activity against mycobacteria, but not against salmonella (PubMed:18322212). Contributes to normal resistance against infection by M.tuberculosis (PubMed:18322212). Required for normal resistance to L.major (PubMed:25030421). Required for normal wound healing, probably by preventing tissue damage by limiting protease activity (PubMed:11017147, PubMed:25030421). Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells (By similarity). {ECO:0000250|UniProtKB:P03973, ECO:0000269|PubMed:11017147, ECO:0000269|PubMed:12615907, ECO:0000269|PubMed:18322212, ECO:0000269|PubMed:25030421, ECO:0000269|PubMed:9039268, ECO:0000269|PubMed:9126337, ECO:0000269|PubMed:9351627, ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (8); Domain (2); Mutagenesis (3); Region (1); Signal peptide (1); Site (1) |
| Keywords | Antibiotic;Antimicrobial;Direct protein sequencing;Disulfide bond;Immunity;Innate immunity;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | INDUCTION: Up-regulated by bacterial lipopolysaccharide (PubMed:9039268, PubMed:25030421). Up-regulated in lung after infection with M.tuberculosis (PubMed:18322212). Down-regulated by IFNG (PubMed:9039268). Up-regulated in lung in response to bacterial pneumonia (PubMed:9351627). Up-regulated in macrophages after exposure to L.major (PubMed:25030421). Not up-regulated in spleen in response to bacterial pneumonia (PubMed:9351627). Up-regulated in wounded skin (PubMed:11017147). {ECO:0000269|PubMed:11017147, ECO:0000269|PubMed:18322212, ECO:0000269|PubMed:25030421, ECO:0000269|PubMed:9039268, ECO:0000269|PubMed:9351627}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:18322212, ECO:0000269|PubMed:9126337}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000269|PubMed:9126337 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 12732717; 12874244; 15034071; 15269824; 15315966; 15650263; 15950183; 16112212; 16470178; 17116754; 17311920; 17982048; 18699806; 19567322; 21112636; 21267068; 21335487; 21335488; 21677750; 21858045; 22436018; 22951731; 24282288; 25110884; 25415419; 25917460; 26121748; 26307669; 26328314; 26644517; 26974397; 27480124; 28539339; 28597116; 31019507; 31597640; 32179912; 33147448; 33157500; 33485930; 33837198; 34379860; 9843921; |
| Motif | |
| Gene Encoded By | |
| Mass | 14,308 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |