Detail Information for IndEnz0002009417
IED ID IndEnz0002009417
Enzyme Type ID protease009417
Protein Name Subtilisin DY
EC 3.4.21.62
Gene Name apr
Organism Bacillus licheniformis
Taxonomic Lineage cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus licheniformis
Enzyme Sequence AQTVPYGIPLIKADKVQAQGYKGANVKVGIIDTGIAASHTDLKVVGGASFVSGESYNTDGNGHGTHVAGTVAALDNTTGVLGVAPNVSLYAIKVLNSSGSGTYSAIVSGIEWATQNGLDVINMSLGGPSGSTALKQAVDKAYASGIVVVAAAGNSGSSGSQNTIGYPAKYDSVIAVGAVDSNKNRASFSSVGAELEVMAPGVSVYSTYPSNTYTSLNGTSMASPHVAGAAALILSKYPTLSASQVRNRLSSTATNLGDSFYYGKGLINVEAAAQ
Enzyme Length 274
Uniprot Accession Number P00781
Absorption
Active Site ACT_SITE 32; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU01240; ACT_SITE 63; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU01240; ACT_SITE 220; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU01240
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins with broad specificity for peptide bonds, and a preference for a large uncharged residue in P1. Hydrolyzes peptide amides.; EC=3.4.21.62;
DNA Binding
EC Number 3.4.21.62
Enzyme Function FUNCTION: Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (3); Beta strand (11); Chain (1); Domain (1); Helix (9); Metal binding (8); Turn (2)
Keywords 3D-structure;Calcium;Direct protein sequencing;Hydrolase;Metal-binding;Protease;Secreted;Serine protease;Sporulation
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D X-ray crystallography (1)
Cross Reference PDB 1BH6;
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 27,436
Kinetics
Metal Binding METAL 2; /note=Calcium 1; METAL 41; /note=Calcium 1; METAL 74; /note=Calcium 1; via carbonyl oxygen; METAL 76; /note=Calcium 1; METAL 80; /note=Calcium 1; via carbonyl oxygen; METAL 168; /note=Calcium 2; via carbonyl oxygen; METAL 170; /note=Calcium 2; via carbonyl oxygen; METAL 173; /note=Calcium 2; via carbonyl oxygen
Rhea ID
Cross Reference Brenda