| IED ID | IndEnz0002009426 |
| Enzyme Type ID | protease009426 |
| Protein Name |
Serine protease SplB EC 3.4.21.- |
| Gene Name | splB SaurJH9_1863 |
| Organism | Staphylococcus aureus (strain JH9) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain JH9) |
| Enzyme Sequence | MNKNVVIKSLATLTILTSVTGIGTTLVEEVQQTAKAENNVTKIQDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK |
| Enzyme Length | 240 |
| Uniprot Accession Number | A5ITX7 |
| Absorption | |
| Active Site | ACT_SITE 75; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q2FXC3; ACT_SITE 113; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q2FXC3; ACT_SITE 193; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q2FXC3 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Serine protease that cleaves specifically after the sequence Trp-Glu-Leu-Gln. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Erroneous initiation (1); Signal peptide (1) |
| Keywords | Hydrolase;Protease;Secreted;Serine protease;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..36; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,141 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |