IED ID | IndEnz0002009437 |
Enzyme Type ID | protease009437 |
Protein Name |
Serglycin Chondroitin sulfate proteoglycan core protein Cytolytic granule proteoglycan core protein PG19 core protein Proteoglycan 10K core protein Secretory granule proteoglycan core protein |
Gene Name | Srgn Pgsg Prg Prg1 |
Organism | Rattus norvegicus (Rat) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
Enzyme Sequence | MRQVPVGTRLVLALAFVLVWGSSVQGYPARRARYQWVRCKPDGIFANCIEEKGPRFDLIAEESNVGPPMTDPVLMRGFPNDFFPISDDYSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSLADMEWEYQPTDENNIVYFNYGPFDRMLTEQNQEQPGDFII |
Enzyme Length | 179 |
Uniprot Accession Number | P04917 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T-lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Compositional bias (1); Disulfide bond (1); Glycosylation (8); Propeptide (1); Region (2); Repeat (24); Signal peptide (1) |
Keywords | Apoptosis;Biomineralization;Direct protein sequencing;Disulfide bond;Glycoprotein;Golgi apparatus;Lysosome;Proteoglycan;Reference proteome;Repeat;Secreted;Signal |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasmic granule {ECO:0000250|UniProtKB:P10124}. Cytolytic granule {ECO:0000250|UniProtKB:P10124}. Secreted, extracellular space {ECO:0000250|UniProtKB:P10124}. Golgi apparatus {ECO:0000250|UniProtKB:P10124}. Note=Found in mast cell granules and in cytoplasmic granules of cytolytic T-lymphocytes from where it is secreted upon cell activation. Secreted constitutively by endothelial cells and macrophages. Located to Golgi apparatus during neutrophil differentiation (By similarity). {ECO:0000250|UniProtKB:P10124, ECO:0000250|UniProtKB:P13609}. |
Modified Residue | |
Post Translational Modification | PTM: O-glycosylated; contains chondroitin sulfate and heparan sulfate. {ECO:0000250}. |
Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 12602945; 9207929; |
Motif | |
Gene Encoded By | |
Mass | 18,577 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |