IED ID | IndEnz0002009443 |
Enzyme Type ID | protease009443 |
Protein Name |
Subtilisin inhibitor-like protein 2 SIL-2 SIL2 |
Gene Name | |
Organism | Streptomyces rochei (Streptomyces parvullus) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces rochei group Streptomyces rochei (Streptomyces parvullus) |
Enzyme Sequence | TAPASLYAPSALVLTIGQGESAAATSPLRAVTLTCAPKATGTHPAADAACAELRRAGGDFDALSAADGVMCTREYAPVVVTVDGVWQGRRLSYERTFANECVKNAGSASVFTF |
Enzyme Length | 113 |
Uniprot Accession Number | P29607 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Inhibitor of subtilisin BPN' and trypsin. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (2); Site (1) |
Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 11,568 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |