| IED ID | IndEnz0002009444 |
| Enzyme Type ID | protease009444 |
| Protein Name |
Staphylococcal superantigen-like 1 EC 3.4.21.- |
| Gene Name | ssl1 NWMN_0388 |
| Organism | Staphylococcus aureus (strain Newman) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain Newman) |
| Enzyme Sequence | MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRITLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLKELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK |
| Enzyme Length | 226 |
| Uniprot Accession Number | A0A0H3KAV3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Mediates virulence by proteolytically cleaving host proteins, including collagens types I and IV as well as human cytokines IL8, IL17A, and IFN-gamma. {ECO:0000269|PubMed:30609641}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Signal peptide (1) |
| Keywords | Hydrolase;Protease;Secreted;Signal;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q2G1S8}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..30; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,647 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |