IED ID | IndEnz0002009511 |
Enzyme Type ID | protease009511 |
Protein Name |
Staphostatin B Staphylococcal cysteine protease B inhibitor |
Gene Name | sspC SAV1046 |
Organism | Staphylococcus aureus (strain Mu50 / ATCC 700699) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain Mu50 / ATCC 700699) |
Enzyme Sequence | MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEITYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV |
Enzyme Length | 109 |
Uniprot Accession Number | Q99V47 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Specifically inhibits the cysteine protease staphopain B (SspB) by blocking the active site of the enzyme. Probably required to protect cytoplasmic proteins from being degraded by prematurely activated/folded prostaphopain B. Also involved in growth capacity, viability and bacterial morphology (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Region (1) |
Keywords | Cytoplasm;Protease inhibitor;Thiol protease inhibitor;Virulence |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 12,869 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |