| IED ID | IndEnz0002009512 |
| Enzyme Type ID | protease009512 |
| Protein Name |
Staphostatin B Staphylococcal cysteine protease B inhibitor |
| Gene Name | sspC SA0899 |
| Organism | Staphylococcus aureus (strain N315) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain N315) |
| Enzyme Sequence | MYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFSSIDNEEITYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV |
| Enzyme Length | 109 |
| Uniprot Accession Number | Q7A6A8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Specifically inhibits the cysteine protease staphopain B (SspB) by blocking the active site of the enzyme. Probably required to protect cytoplasmic proteins from being degraded by prematurely activated/folded prostaphopain B. Also involved in growth capacity, viability and bacterial morphology (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1) |
| Keywords | Cytoplasm;Protease inhibitor;Thiol protease inhibitor;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,869 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |