| IED ID | IndEnz0002009537 |
| Enzyme Type ID | protease009537 |
| Protein Name |
Capsid assembly scaffolding protein Gene product O GpO Head morphogenesis protein Scaffold protein Cleaved into: Maturation protease EC 3.4.21.- |
| Gene Name | O |
| Organism | Escherichia phage P2 (Bacteriophage P2) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Peduovirinae Peduovirus Escherichia phage P2 (Bacteriophage P2) |
| Enzyme Sequence | MAKKVSKFFRIGVEGDTCDGRVISAQDIQEMAETFDPRVYGCRINLEHLRGILPDGIFKRYGDVAELKAEKIDDDSALKGKWALFAKITPTDDLIAMNKAAQKVYTSMEIQPNFANTGKCYLVGLAVTDDPASLGTEYLEFCRTAKHNPLNRFKLSPENLISVATPVELEFEDLPETVFTALTEKVKSIFGRKQASDDARLNDVHEAVTAVAEHVQEKLSATEQRLAEMETAFSALKQEVTDRADETSQAFTRLKNSLDHTESLTQQRRSKATGGGGDALMTNC |
| Enzyme Length | 284 |
| Uniprot Accession Number | P25478 |
| Absorption | |
| Active Site | ACT_SITE 19; /evidence=ECO:0000269|PubMed:19064277; ACT_SITE 48; /evidence=ECO:0000269|PubMed:19064277; ACT_SITE 107; /evidence=ECO:0000269|PubMed:19064277 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Scaffolding protein and protease involved in the icosahedric procapsid assembly. Coassembles with the capsid proteins to form the procapsid, in which the scaffolding protein is found within the external shell of icosahedrally arranged capsid protein subunits. In a subsequent step the scaffolding protein molecules are cleaved by the viral protease activity. {ECO:0000305|PubMed:19064277}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (2); Coiled coil (1); Compositional bias (1); Region (1); Site (1) |
| Keywords | Coiled coil;Hydrolase;Protease;Reference proteome;Serine protease;Viral capsid assembly;Viral capsid maturation;Viral release from host cell |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Autocleaves itself into an N-terminal fragment containing the protease activity, that remains in the capsid following maturation. {ECO:0000269|PubMed:17931675}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,446 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |