| IED ID |
IndEnz0002009563 |
| Enzyme Type ID |
protease009563 |
| Protein Name |
Probable subtilase-type protease inhibitor
|
| Gene Name |
sti1 SAV_7486 |
| Organism |
Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Streptomycetales
Streptomycetaceae
Streptomyces
Streptomyces avermitilis
Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
|
| Enzyme Sequence |
MPNTARWAVTLTLTATAVCGPLAGASLATPNAAASGLYAPSALVLTTGHGQSAATATPERAVTLNCAPTASGTHPAAVSACAELRATGGDFDALSARSDAMCTRQYDPVVVTVEGVWQGKRVAYERTFANECVKNSYGTTVFTF |
| Enzyme Length |
144 |
| Uniprot Accession Number |
Q825H1 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Strong inhibitor of bacterial serine proteases such as subtilisin. {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (2); Signal peptide (1); Site (1) |
| Keywords |
Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..34; /evidence=ECO:0000255 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
14,716 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|