Detail Information for IndEnz0002009567
IED ID IndEnz0002009567
Enzyme Type ID protease009567
Protein Name Staphopain B
EC 3.4.22.-
Staphylococcal cysteine proteinase B
Staphylopain B
Gene Name sspB SAR1021
Organism Staphylococcus aureus (strain MRSA252)
Taxonomic Lineage cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain MRSA252)
Enzyme Sequence MNSSCKTRVFNIISIIMVSMLILSLGAFANNNKAKADSHSKQLEINVKSDKVPQKVKDLAQQQFAGYAKALDKQSNAKTGKYELGEAFKIYKFNGEEDNSYYYPVIKDGKIVYTLTLSPKNKDDLNKSKEDMNYSVKISNFIAKDLDQIKDKNSNITVLTDEKGFYFEEDGKVRLVKATPLANNIKEKESAKTVSPQLKQELKTTVTPTKVEENEAIQEDQVQYENTLKNFKIREQQFDNSWCAGFSMAALLNATKNTDTYNAHDIMRTLYPEVSEQDLPNCATFPNQMIEYGKSQGRDIHYQEGVPSYNQVDQLTKDNVGIMILAQSVSQNPNDPHLGHALAVVANAKINDQEKLIYWNPWDTELSIQDADSSLLHLSFNRDYNWYGSMIGY
Enzyme Length 393
Uniprot Accession Number Q6GI35
Absorption
Active Site ACT_SITE 243; /evidence=ECO:0000250; ACT_SITE 340; /evidence=ECO:0000250; ACT_SITE 360; /evidence=ECO:0000250
Activity Regulation ACTIVITY REGULATION: Prematurely activated/folded staphopain B is inhibited by staphostatin B (SspC), which is probably required to protect staphylococcal cytoplasmic proteins from degradation by SspB. {ECO:0000250}.
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.4.22.-
Enzyme Function FUNCTION: Cysteine protease that plays an important role in the inhibition of host innate immune response. Degrades host elastin, fibrogen, fibronectin and kininogen. Blocks phagocytosis of opsonised S. aureus by neutrophils and monocytes by inducing their death in a proteolytic activity-dependent manner. Decreases surface expression of the 'don't eat me' signal CD31 on neutrophils. Cleaves host galectin-3/LGALS3, thereby inhibiting the neutrophil-activating ability of the lectin. {ECO:0000250|UniProtKB:P0C1S6}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (3); Chain (1); Propeptide (1); Signal peptide (1); Site (1)
Keywords Hydrolase;Protease;Secreted;Signal;Thiol protease;Virulence;Zymogen
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000250}.
Modified Residue
Post Translational Modification PTM: Proteolytically cleaved by staphylococcal serine protease (SspA). {ECO:0000250}.
Signal Peptide SIGNAL 1..36; /evidence=ECO:0000250
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 44,590
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda