| IED ID |
IndEnz0002009572 |
| Enzyme Type ID |
protease009572 |
| Protein Name |
Transcriptional regulator STP3
|
| Gene Name |
STP3 STP1 CAALFM_C304580CA CaO19.13338 CaO19.5917 |
| Organism |
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Opisthokonta
Fungi
Dikarya
Ascomycota
saccharomyceta
Saccharomycotina (true yeasts)
Saccharomycetes
Saccharomycetales
Debaryomycetaceae
Candida/Lodderomyces clade
Candida
Candida albicans (Yeast)
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
|
| Enzyme Sequence |
MLILSIGLIHHTSNKSLYTISPNKGKRYEPFTTTSLGNFQFHVVRFLHRLIYGTQRYQELFPPIQKIKNINNVKQQRIFPVNCAADDLDLGFGESDQIELFNHPSKDTYGQFNLIQLIDIFDPPQVHAPSSADEFFKSNKGSEHIDIFDMITRQPPPFHQHQLNIETPYFEDFATPLVLPPHEVSSDDVESYFSGSVSTVSSIEPLDDEFVPPPQPPRTHTSRKRKHDSISPPASSDSSSSSSYVPQLIPSSSSSVTSNGDSPVSPTTKRKYTKKKQPVFSNVDEPIVITTTTKTNNIDVKKITTTKNGTVENRFDCPSCDASFKVKGYLTRHLKKHSTSKAFECPFFDNHGVHGSKCHPTGGFSRRDTFKVHLRALHFIYPAGVKASQRNSFNGRCAGCFQYFDNNSEWLENHIEAGKCTGTVQYKQNVSNLLLD |
| Enzyme Length |
436 |
| Uniprot Accession Number |
Q5ANI6 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Transcription factor that activates genes required for degradation of extracellular protein and uptake of peptides such as the secreted aspartyl protease SAP2 or the oligopeptide transporter OPT1. Required for virulence. Synthesized as latent cytoplasmic precursor, which, upon a signal initiated by the plasma membrane SPS amino acid sensor system (including CSY1 and CSH3), becomes proteolytically activated and relocates to the nucleus, where it induces the expression of SPS-sensor-regulated genes. {ECO:0000269|PubMed:16227594, ECO:0000269|PubMed:18547391, ECO:0000269|PubMed:22110651}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Compositional bias (1); Propeptide (1); Region (1); Zinc finger (1) |
| Keywords |
Cell membrane;DNA-binding;Membrane;Metal-binding;Nucleus;Reference proteome;Repeat;Virulence;Zinc;Zinc-finger;Zymogen |
| Interact With |
|
| Induction |
INDUCTION: Expression is down-regulated in presence of extracellular amino acids. {ECO:0000269|PubMed:16227594}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}; Cytoplasmic side {ECO:0000250}. Nucleus {ECO:0000250}. Note=Localizes to the cytoplasm in its unprocessed form and is targeted to the nucleus after proteolytic processing upon induction by amino acids. {ECO:0000250}. |
| Modified Residue |
|
| Post Translational Modification |
PTM: Activated by the amino acid-induced proteolytic removal of an N-terminal inhibitory domain. |
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
49,092 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|