| IED ID | IndEnz0002009598 |
| Enzyme Type ID | protease009598 |
| Protein Name |
Extracellular metalloprotease AO090012001025 EC 3.4.24.- |
| Gene Name | AO090012001025 |
| Organism | Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Circumdati Aspergillus oryzae (Yellow koji mold) Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold) |
| Enzyme Sequence | MSHFPTLHILILVIANLQIQCFAFVSQSRGFCATGPPTESLKAEYRRLSALGSQSYNPVDSESRAAITPIVIDTWFHIITGEAGTELISDEMIADQLSYLQNAYWNATISYRLQGVTRSANDTWARNEDEMAMKTVLRRGSYRTLNVYFHTDLQASPNAGARAFDIVRRELGVSQQQPTSMLGFCTLPDPSINASSPPSTYIKDGCNVLAETMPGGSLAHYNRGGTAIHEIGHWNGLLHTFEGESCSSDNEGDFIADTPQQSKPTEGCPAQKDSCPELPGFDAIHNFMDYSSDECYDSFTPDQVSRMRSMWFAMRDGK |
| Enzyme Length | 318 |
| Uniprot Accession Number | Q2UBF0 |
| Absorption | |
| Active Site | ACT_SITE 230; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Secreted metalloproteinase that allows assimilation of proteinaceous substrates. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (1); Glycosylation (3); Metal binding (2); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Secreted;Signal;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,208 |
| Kinetics | |
| Metal Binding | METAL 229; /note=Zinc; catalytic; /evidence=ECO:0000250; METAL 233; /note=Zinc; catalytic; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |