| IED ID | IndEnz0002009610 |
| Enzyme Type ID | protease009610 |
| Protein Name |
Effector protein NleF Non-LEE-encoded type III effector F |
| Gene Name | nleF Z6020.1 ECs1815 |
| Organism | Escherichia coli O157:H7 |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O157:H7 |
| Enzyme Sequence | MLPTSGSSANLYSWMYVSGRGNPSTPESVSELNHNHFLSPELQDKLDVMVSIYSCARNNNELEEIFQELSAFVSGLMDKRNSVFEVRNENTDEVVGALRAGMTIEDRDSYIRDLFFLHSLKVKIEESRQGKEDSKCKVYNLLCPHHSSELYGDLRAMKCLVEGCSDDFNPFDIIRVPDLTYNKGSLQCG |
| Enzyme Length | 189 |
| Uniprot Accession Number | Q8XAL7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Effector protein that alters host cell physiology and promotes bacterial survival in host tissues. Inhibits the catalytic activity of human CASP4, CASP8 and CASP9, and thereby inhibits apoptosis of infected host cells. {ECO:0000269|PubMed:18279332, ECO:0000269|PubMed:23516580}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Helix (6); Mutagenesis (7); Region (1); Turn (2) |
| Keywords | 3D-structure;Host cytoplasm;Protease inhibitor;Reference proteome;Secreted |
| Interact With | P55211; P49755 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:18279332}. Host cytoplasm {ECO:0000269|PubMed:18279332}. Note=Injected into host cells via a type III secretion system. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 3V3K; |
| Mapped Pubmed ID | 25519916; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,388 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |