| IED ID | IndEnz0002009613 |
| Enzyme Type ID | protease009613 |
| Protein Name |
Pre-histone-like nucleoprotein Pre-core protein VII pVII Cleaved into: Histone-like nucleoprotein NP Core protein VII |
| Gene Name | |
| Organism | Fowl adenovirus A serotype 1 (strain CELO / Phelps) (FAdV-1) (Avian adenovirus gal1 (strain Phelps)) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Aviadenovirus Fowl aviadenovirus A Fowl adenovirus A serotype 1 (strain CELO / Phelps) (FAdV-1) (Avian adenovirus gal1 (strain Phelps)) |
| Enzyme Sequence | MSILISPSDNRGWGANMRYRRRASMRGVGRRRLTLRQLLGLGSRRRRRSRPTTVSNRLVVVSTRRRSSRRRR |
| Enzyme Length | 72 |
| Uniprot Accession Number | Q89707 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Strongly bound to viral DNA and responsible for wrapping and condensing the viral DNA. Probably promotes viral genome import into the nucleus and is still associated with the viral DNA when the latter enters into the host nucleus (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Initiator methionine (1); Modified residue (1); Propeptide (1); Site (1) |
| Keywords | Acetylation;DNA-binding;Host nucleus;Late protein;Reference proteome;Viral penetration into host nucleus;Virion;Virus entry into host cell |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. |
| Subcellular Location | SUBCELLULAR LOCATION: [Pre-histone-like nucleoprotein]: Host nucleus, host nucleolus {ECO:0000250}.; SUBCELLULAR LOCATION: [Histone-like nucleoprotein]: Virion {ECO:0000250}. Note=Located inside the capsid in association with the viral DNA (core). Present in about 1070 copies per virion (By similarity). {ECO:0000250}. |
| Modified Residue | MOD_RES 2; /note=N-acetylserine; by host; /evidence=ECO:0000250 |
| Post Translational Modification | PTM: Cleaved near the N-terminus by the viral protease during virion maturation to form the mature protein. {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,563 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |