| IED ID | IndEnz0002009626 |
| Enzyme Type ID | protease009626 |
| Protein Name |
Plasminogen EC 3.4.21.7 Fragments |
| Gene Name | |
| Organism | Petromyzon marinus (Sea lamprey) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Cyclostomata (jawless vertebrates) Hyperoartia Petromyzontiformes Petromyzontidae Petromyzon Petromyzon marinus (Sea lamprey) |
| Enzyme Sequence | APIKGYSVTVXLYIFDCQKWSSNYPHKPNFSDATDPKGPWCYTTDYXGAASVTRSGLRGDEQTPHRHTFSPQSFAGLTTACVKGTGEGYRGTAALTVSGKACQAWASQTPGDVYSCQGLVSNYCRNPDGEKLPWCYTTEYCNVPSCTGGPTGSEYHEILTPAQDXYTGIVEDYRGKMSPDAGLEENFCRNPDQDPQGPWCYTXNPEAXPRYCDVLSVVGGXEAQRNSXPRQISLQYGWQTVHVQSIHAEPRGVDIALVKIAPPAQLTACVITXWGETQGTGEDVQFCAGYPEGGTDPVSLVCLEPCVLAPVLVGVVILPXNDRXQ |
| Enzyme Length | 325 |
| Uniprot Accession Number | P33574 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: Lys-|-Xaa > Arg-|-Xaa, higher selectivity than trypsin. Converts fibrin into soluble products.; EC=3.4.21.7; |
| DNA Binding | |
| EC Number | 3.4.21.7 |
| Enzyme Function | FUNCTION: Plasmin dissolves the fibrin of blood clots and acts as a proteolytic factor in a variety of other processes including embryonic development, tissue remodeling, tumor invasion, and inflammation. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (4); Domain (2); Non-adjacent residues (15); Non-terminal residue (1) |
| Keywords | Blood coagulation;Direct protein sequencing;Disulfide bond;Fibrinolysis;Hemostasis;Hydrolase;Kringle;Protease;Reference proteome;Secreted;Serine protease;Tissue remodeling;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,206 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |