IED ID | IndEnz0002009669 |
Enzyme Type ID | protease009669 |
Protein Name |
Abasic site processing protein YobE EC 3.4.-.- |
Gene Name | yobE BSU18880 |
Organism | Bacillus subtilis (strain 168) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
Enzyme Sequence | MCGKFTLFSEFDDIIEQFNIDQFLPEGEYHPSYNVAPSQNILTIINDGSNNRLGKLRWGLIPPCAKDEKIGYKMINARAETLAEKPSFRKPLGSKRCIIPADSFYEWKRLDPKTKIPMRIKLKSSNLFAFAGLYEKWNTLEGNLLYTCTIITIKPSELMEDIHDRMPVILTDENKKEWLNPKNTDPDYLQSLLLPYDADDMEAYQVSSLVNSPELIESH |
Enzyme Length | 219 |
Uniprot Accession Number | O34915 |
Absorption | |
Active Site | ACT_SITE 2; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q96FZ2 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.-.- |
Enzyme Function | FUNCTION: Sensor of abasic sites in single-stranded DNA (ssDNA) required to preserve genome integrity by promoting error-free repair of abasic sites. Recognizes and binds abasic sites in ssDNA at replication forks and chemically modifies the lesion by forming a covalent cross-link with DNA: forms a stable thiazolidine linkage between a ring-opened abasic site and the alpha-amino and sulfhydryl substituents of its N-terminal catalytic cysteine residue (By similarity). May act as a protease: mediates autocatalytic processing of its N-terminal methionine in order to expose the catalytic cysteine (By similarity). {ECO:0000250|UniProtKB:P76318, ECO:0000250|UniProtKB:Q8R1M0}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Initiator methionine (1); Modified residue (1); Site (2) |
Keywords | Covalent protein-DNA linkage;DNA damage;DNA-binding;Hydrolase;Protease;Reference proteome;SOS response |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | MOD_RES 2; /note=Thiazolidine linkage to a ring-opened DNA abasic site; /evidence=ECO:0000250|UniProtKB:P76318 |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 25,241 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |