| IED ID |
IndEnz0002009673 |
| Enzyme Type ID |
protease009673 |
| Protein Name |
Uncharacterized protein YqjE
|
| Gene Name |
yqjE BSU23910 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MVNEKRLLEEFLELVQIDSETKHEAEICKVLKRKFSDLGVDVKEDDTMDITGHGAGNLICTLKGTKQTDTIYFTSHMDTVVPGNGVKPVVENGYVKTDGTTILGADDKAGLAAMFEAIKVLKEENIEHGTIEFIITVGEESGLIGAKALDRSMITASYGYALDSDGKVGNIIVAAPTQAKVRAAIFGKTAHAGVEPEKGISAITIASKAISKMPLGRIDEETTANIGRFEGGTQTNIVCDEVHILAEARSLVPEKMEAQVQKMKAAFEEAAADMGGRAEVEIEVMYPGFKYQDGDQVVEIAKKAAAKIGRPSELQTSGGGSDANVIAGHGIPTVNLAVGYEQIHTKNEKMPIEELVKTAEMVVAIIEEAAK |
| Enzyme Length |
371 |
| Uniprot Accession Number |
P54542 |
| Absorption |
|
| Active Site |
ACT_SITE 78; /evidence=ECO:0000250; ACT_SITE 139; /note=Proton acceptor; /evidence=ECO:0000250 |
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Could be a peptidase. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Active site (2); Chain (1); Metal binding (6); Sequence conflict (1) |
| Keywords |
Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Zinc |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
39,647 |
| Kinetics |
|
| Metal Binding |
METAL 76; /note=Zinc 1; /evidence=ECO:0000250; METAL 106; /note=Zinc 1; /evidence=ECO:0000250; METAL 106; /note=Zinc 2; /evidence=ECO:0000250; METAL 140; /note=Zinc 2; /evidence=ECO:0000250; METAL 163; /note=Zinc 1; /evidence=ECO:0000250; METAL 344; /note=Zinc 2; /evidence=ECO:0000250 |
| Rhea ID |
|
| Cross Reference Brenda |
|