IED ID | IndEnz0002009728 |
Enzyme Type ID | protease009728 |
Protein Name |
Serine protease inhibitor kazal-like protein, minor form SPINKL, minor form Cleaved into: Serine protease inhibitor kazal-like protein, major form SPINKL, major form |
Gene Name | Spinkl |
Organism | Mus musculus (Mouse) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
Enzyme Sequence | MSSTWIKFLFILTLVLLPYSVFSVNIFAGPENVIKEPNCTMYKSKSECSNIAENPVCADDRNTYYNECYFCIEKVVEKLKYRYHGICIYK |
Enzyme Length | 90 |
Uniprot Accession Number | Q8CEK3 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Does not function as an inhibitor of trypsin, chymotrypsin, subtilisin or elastase. Binds sperm and enhances sperm motility. May act as a decapacitation factor, suppresses BSA-stimulated sperm capacitation and blocks sperm-oocyte interactions in vitro. {ECO:0000269|PubMed:18715980}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (2); Domain (1); Glycosylation (1); Signal peptide (1) |
Keywords | Direct protein sequencing;Glycoprotein;Reference proteome;Secreted;Signal |
Interact With | |
Induction | INDUCTION: By testosterone. {ECO:0000269|PubMed:18715980}. |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:18715980}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000269|PubMed:18715980 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 11217851; 12466851; 21267068; 21677750; 23097296; |
Motif | |
Gene Encoded By | |
Mass | 10,542 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |