| IED ID | IndEnz0002009730 |
| Enzyme Type ID | protease009730 |
| Protein Name |
Serpin B3 Protein T4-A Squamous cell carcinoma antigen 1 SCCA-1 |
| Gene Name | SERPINB3 SCCA SCCA1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
| Enzyme Length | 390 |
| Uniprot Accession Number | P29508 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May act as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Also functions as an inhibitor of UV-induced apoptosis via suppression of the activity of c-Jun NH(2)-terminal kinase (JNK1). {ECO:0000269|PubMed:19166818}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Beta strand (16); Chain (1); Erroneous initiation (1); Helix (14); Modified residue (1); Mutagenesis (4); Natural variant (2); Sequence conflict (7); Site (1); Turn (6) |
| Keywords | 3D-structure;Acetylation;Alternative splicing;Cytoplasm;Direct protein sequencing;Protease inhibitor;Reference proteome;Serine protease inhibitor |
| Interact With | |
| Induction | INDUCTION: Strongly up-regulated in the upper epidermis of sun-exposed skin. {ECO:0000269|PubMed:19166818}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:10956412, ECO:0000269|PubMed:14970861}. Note=Seems to also be secreted in plasma by cancerous cells but at a low level. |
| Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0000269|Ref.13 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 2ZV6; 4ZK0; 4ZK3; |
| Mapped Pubmed ID | 12773976; 12820321; 12874860; 12949073; 14654899; 14719077; 14743216; 14993646; 15001834; 15677460; 15733534; 15902720; 15906357; 16681421; 16701102; 17353931; 17523076; 18078639; 18155162; 18385761; 18657489; 19070595; 19112206; 19332150; 19423540; 19959474; 20089382; 20406964; 20428762; 20438785; 20562859; 20586028; 20840788; 21526154; 21737255; 22088515; 22359459; 22406480; 22451727; 22563932; 22808225; 22829702; 22999061; 23185467; 23239141; 23349993; 23383155; 23712355; 24162160; 24247658; 24366813; 24389432; 24503858; 24635038; 24737009; 24809782; 24810714; 24898082; 24905620; 24962668; 25111616; 25129443; 25544768; 25609649; 25622661; 25840050; 26408719; 26432331; 26634820; 26730601; 26877539; 27095020; 27435426; 27668655; 28178650; 28609160; 28901315; 28935635; 29112685; 29124154; 29524519; 30952746; 31247344; 31282406; 31426690; 31607648; 32085736; 32221801; 32569142; 33110054; 34886853; 8692836; |
| Motif | |
| Gene Encoded By | |
| Mass | 44,565 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |