| IED ID | IndEnz0002009782 |
| Enzyme Type ID | protease009782 |
| Protein Name |
Small, acid-soluble spore protein 1 SASP |
| Gene Name | Sh-1 HBHAL_2184 |
| Organism | Halobacillus halophilus (strain ATCC 35676 / DSM 2266 / JCM 20832 / KCTC 3685 / LMG 17431 / NBRC 102448 / NCIMB 2269) (Sporosarcina halophila) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Halobacillus Halobacillus halophilus (Sporosarcina halophila) Halobacillus halophilus (strain ATCC 35676 / DSM 2266 / JCM 20832 / KCTC 3685 / LMG 17431 / NBRC 102448 / NCIMB 2269) (Sporosarcina halophila) |
| Enzyme Sequence | MANNNSSNELVVPGVQQALDQMKYEIAQEFGVQLGADSTSRANGSVGGEITKRLVQMAEQQFGGQQYGQQQK |
| Enzyme Length | 72 |
| Uniprot Accession Number | Q00213 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: SASP are bound to spore DNA. They are double-stranded DNA-binding proteins that cause DNA to change to an a-like conformation. They protect the DNA backbone from chemical and enzymatic cleavage and are thus involved in dormant spore's high resistance to UV light. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Site (1) |
| Keywords | DNA-binding;Reference proteome;Sporulation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,790 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |