| IED ID | IndEnz0002009785 |
| Enzyme Type ID | protease009785 |
| Protein Name |
Protein S100-A14 S100 calcium-binding protein A14 S114 |
| Gene Name | S100A14 S100A15 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH |
| Enzyme Length | 104 |
| Uniprot Accession Number | Q9HCY8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium. {ECO:0000269|PubMed:21559403, ECO:0000269|PubMed:22032898, ECO:0000269|PubMed:22451655}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (2); Chain (1); Domain (1); Helix (5); Turn (2) |
| Keywords | 3D-structure;Apoptosis;Cytoplasm;Reference proteome |
| Interact With | P43360; Q99584; Q96FQ6 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:11944983}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 2M0R; |
| Mapped Pubmed ID | 16189514; 19351828; 19601998; 19956863; 23886191; 24086685; 24107296; 24189400; 24285542; 24366813; 24939856; 25266115; 25416956; 25502330; 25640309; 25884418; 25912829; 27270322; 28498804; 28726786; 28950283; 29733545; 31882495; 32202693; 32483412; 32555330; 32984913; 33579599; 33890248; |
| Motif | |
| Gene Encoded By | |
| Mass | 11,662 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |