| IED ID |
IndEnz0002009788 |
| Enzyme Type ID |
protease009788 |
| Protein Name |
Secretion monitor
|
| Gene Name |
secM Ecok1_00880 APECO1_1889 |
| Organism |
Escherichia coli O1:K1 / APEC |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Enterobacteriaceae
Escherichia
Escherichia coli
Escherichia coli O1:K1 / APEC
|
| Enzyme Sequence |
MSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNAAEPNAPAKATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPVAEESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIRAGPQRLS |
| Enzyme Length |
170 |
| Uniprot Accession Number |
A1A7E2 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Regulates secA expression by translational coupling of the secM secA operon. Translational pausing at a specific Pro residue 5 residues before the end of the protein may allow disruption of a mRNA repressor helix that normally suppresses secA translation initiation. {ECO:0000255|HAMAP-Rule:MF_01332}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Erroneous initiation (1); Signal peptide (1) |
| Keywords |
Cytoplasm;Periplasm;Signal |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000255|HAMAP-Rule:MF_01332}. Periplasm {ECO:0000255|HAMAP-Rule:MF_01332}. Note=The active form is cytosolic, while the periplasmic form is rapidly degraded, mainly by the tail-specific protease. {ECO:0000255|HAMAP-Rule:MF_01332}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..37; /evidence=ECO:0000255|HAMAP-Rule:MF_01332 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
18,866 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|