| IED ID | IndEnz0002009812 |
| Enzyme Type ID | protease009812 |
| Protein Name |
Serine protease SplB EC 3.4.21.- |
| Gene Name | splB SAOUHSC_01941 |
| Organism | Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Enzyme Sequence | MNKNVVIKSLAALTILTSVTGIGTTLVEEVQQTAKAENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK |
| Enzyme Length | 240 |
| Uniprot Accession Number | Q2FXC3 |
| Absorption | |
| Active Site | ACT_SITE 75; /note=Charge relay system; /evidence=ECO:0000269|PubMed:18448121; ACT_SITE 113; /note=Charge relay system; /evidence=ECO:0000269|PubMed:18448121; ACT_SITE 193; /note=Charge relay system; /evidence=ECO:0000269|PubMed:18448121 |
| Activity Regulation | ACTIVITY REGULATION: Maintained latent until the signal peptide is removed by signal peptidase. {ECO:0000269|PubMed:16516230}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Serine protease that cleaves specifically after the sequence Trp-Glu-Leu-Gln. {ECO:0000269|PubMed:18448121}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.0-8.5. {ECO:0000269|PubMed:18448121}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (17); Chain (1); Helix (5); Mutagenesis (1); Signal peptide (1) |
| Keywords | 3D-structure;Direct protein sequencing;Hydrolase;Protease;Reference proteome;Secreted;Serine protease;Signal |
| Interact With | |
| Induction | INDUCTION: Positively regulated by agr (accessory gene regulator). {ECO:0000269|PubMed:11179322}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:11179322, ECO:0000269|PubMed:16516230}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..36; /evidence="ECO:0000269|PubMed:11179322, ECO:0000269|PubMed:16516230, ECO:0000269|PubMed:18448121" |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 2VID; 4K1S; 4K1T; |
| Mapped Pubmed ID | 24713703; |
| Motif | |
| Gene Encoded By | |
| Mass | 26,097 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |