| IED ID | IndEnz0002009822 |
| Enzyme Type ID | protease009822 |
| Protein Name |
Small, acid-soluble spore protein gamma-type SASP |
| Gene Name | sspE BSU08660 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MANSNNFSKTNAQQVRKQNQQSAAGQGQFGTEFASETNAQQVRKQNQQSAGQQGQFGTEFASETDAQQVRQQNQSAEQNKQQNS |
| Enzyme Length | 84 |
| Uniprot Accession Number | P07784 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: SASP are proteins degraded in the first minutes of spore germination and provide amino acids for both new protein synthesis and metabolism. These proteins may be involved in dormant spore's high resistance to UV light. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Region (1); Repeat (2); Site (2) |
| Keywords | Reference proteome;Repeat;Sporulation |
| Interact With | |
| Induction | INDUCTION: Monocistronically transcribed in the late sporulation phase and cotranscribed with mutY and/or fabL during exponential growth. However, sspE is not translated during this period. {ECO:0000269|PubMed:10463184}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,268 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |