Detail Information for IndEnz0002009847
IED ID IndEnz0002009847
Enzyme Type ID protease009847
Protein Name Venom protein Vn4.6
Gene Name
Organism Cotesia rubecula (Cabbage white butterfly parasite) (Apanteles rubecula)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Hymenoptera Apocrita (wasps ants and bees) Parasitoida Ichneumonoidea Braconidae Microgastrinae Cotesia Cotesia rubecula (Cabbage white butterfly parasite) (Apanteles rubecula)
Enzyme Sequence MSKIILAIFLIVLCGLIFVTVDAMIDAPCKDNDDCDRFTEYCAIYADENGNEAGKRCEDAIGLLV
Enzyme Length 65
Uniprot Accession Number Q8WQK0
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Endoparasitoid venom protein that interferes with the activation of host hemolymph prophenoloxidase. May act in conjunction with other venom proteins (such as Vn50), by competitive binding to the zymogen and thereby interrupting the enzyme. {ECO:0000269|PubMed:12761876}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Signal peptide (1)
Keywords Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Signal
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:12761876}.
Modified Residue
Post Translational Modification PTM: Contains 2 disulfide bonds.
Signal Peptide SIGNAL 1..23; /evidence=ECO:0000269|PubMed:12761876
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 7,133
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda