Detail Information for IndEnz0002009856
IED ID IndEnz0002009856
Enzyme Type ID protease009856
Protein Name Pro-vaccinia growth factor
Pro-VGF

Cleaved into: Vaccinia growth factor
VGF
Secreted epidermal growth factor-like
Gene Name VGF C11R
Organism Vaccinia virus (strain Copenhagen) (VACV)
Taxonomic Lineage Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Copenhagen) (VACV)
Enzyme Sequence MSMKYLMLLFAAMIIRSFADSGNAIETTLPEITNATTDIPAIRLCGPEGDGYCLHGDCIHARDIDGMYCRCSHGYTGIRCQHVVLVDYQRSENPNTTTSYIPSPGIMLVLVGIIIIITCCLLSVYRFTRRTNKLPLQDMVVP
Enzyme Length 142
Uniprot Accession Number P20494
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Vaccinia growth factor stimulates cellular proliferation (hyperplasia) around infected cells. This effect is beneficial for virus replication in vivo, because poxviruses replicate possibly better in proliferating cells than in quiescent cells. Acts by binding host EGFR, inducing its dimerization, autophosphorylation and leading to activation of several cellular pathways regulating cell proliferation or cell survival. The activation by host EGFR of mitogen activated protein kinases (MAPK) and extracellular-signal regulated kinases (ERK) are essential for the positive effect of vaccinia growth factor on poxvirus virulence in vivo (By similarity). {ECO:0000250}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (2); Disulfide bond (3); Domain (1); Glycosylation (2); Signal peptide (1); Site (1); Topological domain (2); Transmembrane (1)
Keywords Disulfide bond;EGF-like domain;Glycoprotein;Growth factor;Host membrane;Host-virus interaction;Membrane;Reference proteome;Secreted;Signal;Transmembrane;Transmembrane helix
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: [Pro-vaccinia growth factor]: Host membrane {ECO:0000250|UniProtKB:P01136}; Single-pass type I membrane protein {ECO:0000250|UniProtKB:P01136}.; SUBCELLULAR LOCATION: [Vaccinia growth factor]: Secreted {ECO:0000250|UniProtKB:P01136}.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..18; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 15,777
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda