IED ID | IndEnz0002009856 |
Enzyme Type ID | protease009856 |
Protein Name |
Pro-vaccinia growth factor Pro-VGF Cleaved into: Vaccinia growth factor VGF Secreted epidermal growth factor-like |
Gene Name | VGF C11R |
Organism | Vaccinia virus (strain Copenhagen) (VACV) |
Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Copenhagen) (VACV) |
Enzyme Sequence | MSMKYLMLLFAAMIIRSFADSGNAIETTLPEITNATTDIPAIRLCGPEGDGYCLHGDCIHARDIDGMYCRCSHGYTGIRCQHVVLVDYQRSENPNTTTSYIPSPGIMLVLVGIIIIITCCLLSVYRFTRRTNKLPLQDMVVP |
Enzyme Length | 142 |
Uniprot Accession Number | P20494 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Vaccinia growth factor stimulates cellular proliferation (hyperplasia) around infected cells. This effect is beneficial for virus replication in vivo, because poxviruses replicate possibly better in proliferating cells than in quiescent cells. Acts by binding host EGFR, inducing its dimerization, autophosphorylation and leading to activation of several cellular pathways regulating cell proliferation or cell survival. The activation by host EGFR of mitogen activated protein kinases (MAPK) and extracellular-signal regulated kinases (ERK) are essential for the positive effect of vaccinia growth factor on poxvirus virulence in vivo (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (2); Disulfide bond (3); Domain (1); Glycosylation (2); Signal peptide (1); Site (1); Topological domain (2); Transmembrane (1) |
Keywords | Disulfide bond;EGF-like domain;Glycoprotein;Growth factor;Host membrane;Host-virus interaction;Membrane;Reference proteome;Secreted;Signal;Transmembrane;Transmembrane helix |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: [Pro-vaccinia growth factor]: Host membrane {ECO:0000250|UniProtKB:P01136}; Single-pass type I membrane protein {ECO:0000250|UniProtKB:P01136}.; SUBCELLULAR LOCATION: [Vaccinia growth factor]: Secreted {ECO:0000250|UniProtKB:P01136}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 15,777 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |