| IED ID | IndEnz0002009894 |
| Enzyme Type ID | protease009894 |
| Protein Name |
Sentrin-specific protease 8 EC 3.4.22.- Deneddylase-1 NEDD8-specific protease 1 Sentrin/SUMO-specific protease SENP8 |
| Gene Name | Senp8 Den1 Nedp1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVCFISPEVTQFIKCTSSPAEIAMFLEPLDLPHKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSIHAKQVAEKLKAFLGSKGDKLVFVEEKAPAQENSYDCGMYVICNTEALCQSLFRRQPESPLQLLTPTYITKKRGEWKDLIARLAKKNEVATEECS |
| Enzyme Length | 221 |
| Uniprot Accession Number | Q9D2Z4 |
| Absorption | |
| Active Site | ACT_SITE 102; /evidence=ECO:0000250; ACT_SITE 119; /evidence=ECO:0000250; ACT_SITE 163; /note=Nucleophile; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53. {ECO:0000269|PubMed:12759362}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Erroneous initiation (1); Modified residue (1); Region (1) |
| Keywords | Acetylation;Hydrolase;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0000250|UniProtKB:Q96LD8 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10725249; 11217851; 12466851; 12730221; 12759363; 12796513; 12904583; 14610273; 18799693; 21267068; 25581363; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,057 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |