| IED ID | IndEnz0002009904 |
| Enzyme Type ID | protease009904 |
| Protein Name |
Small proline-rich protein 3 22 kDa pancornulin Cornifin beta Esophagin |
| Gene Name | SPRR3 SPRC |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK |
| Enzyme Length | 169 |
| Uniprot Accession Number | Q9UBC9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cross-linked envelope protein of keratinocytes. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Initiator methionine (1); Modified residue (1); Natural variant (3); Region (3); Repeat (14); Sequence conflict (4) |
| Keywords | Acetylation;Cytoplasm;Direct protein sequencing;Keratinization;Reference proteome;Repeat |
| Interact With | |
| Induction | INDUCTION: During squamous differentiation of epidermal keratinocytes. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. |
| Modified Residue | MOD_RES 2; /note=N-acetylserine; /evidence=ECO:0000269|PubMed:20599699 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10066784; 10411887; 10771479; 11350120; 11590230; 12902340; 14748073; 15221970; 16639001; 17515931; 17935133; 18643845; 18832573; 19211270; 20379613; 21490620; 21654840; 21777580; 22076481; 23820115; 27304082; 30850686; 7543090; 8999895; 9395522; 9565599; |
| Motif | |
| Gene Encoded By | |
| Mass | 18,154 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |