| IED ID | IndEnz0002009947 |
| Enzyme Type ID | protease009947 |
| Protein Name |
Protein UmuD EC 3.4.21.- DNA polymerase V Pol V Cleaved into: Protein UmuD' |
| Gene Name | umuD b1183 JW1172 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVKAMR |
| Enzyme Length | 139 |
| Uniprot Accession Number | P0AG11 |
| Absorption | |
| Active Site | ACT_SITE 60; /note=For autocatalytic cleavage activity; ACT_SITE 97; /note=For autocatalytic cleavage activity |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Involved in UV protection and mutation. Poorly processive, error-prone DNA polymerase involved in translesion repair (PubMed:10801133). Essential for induced (or SOS) mutagenesis. Able to replicate DNA across DNA lesions (thymine photodimers and abasic sites, called translesion synthesis) in the presence of activated RecA; efficiency is maximal in the presence of the beta sliding-clamp and clamp-loading complex of DNA polymerase III plus single-stranded binding protein (SSB) (PubMed:10801133). RecA and to a lesser extent the beta clamp-complex may target Pol V to replication complexes stalled at DNA template lesions (PubMed:10801133). {ECO:0000269|PubMed:10801133}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (10); Chain (2); Helix (3); Mutagenesis (3); Site (1) |
| Keywords | 3D-structure;Autocatalytic cleavage;DNA damage;DNA repair;Hydrolase;Protease;Reference proteome;SOS mutagenesis;SOS response;Serine protease |
| Interact With | Itself; P04152 |
| Induction | INDUCTION: Repressed by LexA, induced by DNA damage (PubMed:10760155). Induced 1.5-fold by hydroxyurea (PubMed:20005847). {ECO:0000269|PubMed:10760155, ECO:0000269|PubMed:20005847}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (2) |
| Cross Reference PDB | 1AY9; 1I4V; 1UMU; |
| Mapped Pubmed ID | 11483531; 16606699; 24561554; 6302271; 6311684; 8994967; |
| Motif | |
| Gene Encoded By | |
| Mass | 15,063 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.B30; |