| IED ID | IndEnz0002009962 |
| Enzyme Type ID | protease009962 |
| Protein Name |
Zinc metalloproteinase-disintegrin salmosin-3 EC 3.4.24.- Snake venom metalloproteinase SVMP Fragment |
| Gene Name | |
| Organism | Gloydius brevicaudus (Korean slamosa snake) (Agkistrodon halys brevicaudus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Gloydius Gloydius brevicaudus (Korean slamosa snake) (Agkistrodon halys brevicaudus) |
| Enzyme Sequence | SCPCDANSCIMSATLSNEPSSRFSDCSFSLPSRFSDCSFNQYSSDIIHYHECLLNEPSRTDIVSPPVCGNYYPEVGEDCDCGPPANCQNPCCDAATCGLTTGSQCAEGLCCDQCRLKKAGTICRKARGDNPDDRCTGQSGVCPRNT |
| Enzyme Length | 146 |
| Uniprot Accession Number | O93515 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Snake venom zinc metalloproteinase that inhibits ADP-induced platelet aggregation (probably by binding integrin alpha-IIb/beta-3 (ITGA2B/ITGB3)) and degrades fibrinogen. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (9); Domain (2); Motif (1); Non-terminal residue (1) |
| Keywords | Cell adhesion impairing toxin;Disulfide bond;Hemostasis impairing toxin;Hydrolase;Metal-binding;Metalloprotease;Platelet aggregation inhibiting toxin;Protease;Secreted;Toxin;Zinc;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 127..129; /note=Cell attachment site |
| Gene Encoded By | |
| Mass | 15,620 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |