| IED ID | IndEnz0002010021 | 
                    
                        | Enzyme Type ID | protease010021 | 
                    
                        | Protein Name | Cell division inhibitor SulA 
 | 
                    
                        | Gene Name | sulA | 
                    
                        | Organism | Serratia marcescens | 
                    
                        | Taxonomic Lineage | cellular organisms
                            
                                
                            
                        
                             Bacteria
                            
                                
                            
                        
                             Proteobacteria
                            
                                
                            
                        
                             Gammaproteobacteria
                            
                                
                            
                        
                             Enterobacterales
                            
                                
                            
                        
                             Yersiniaceae
                            
                                
                            
                        
                             Serratia
                            
                                
                            
                        
                             Serratia marcescens | 
                    
                        | Enzyme Sequence | MRTQSLYQPHFGHGSYTTRNVAKNTDIGKENGLISELVYNERQPAVAQLLLPLLLQLGKQSRWLLWLTPQQKLSKQWLQQSGLPVDKMVQLSQISPVNTVEAMEKALQTGNYSVVLGWLPELTEEDRLKLRRAAELGNAYGFIMRPQRDISPTHGHCSTLKIHSSLYH | 
                    
                        | Enzyme Length | 168 | 
                    
                        | Uniprot Accession Number | P08845 | 
                    
                        | Absorption |  | 
                    
                        | Active Site |  | 
                    
                        | Activity Regulation |  | 
                    
                        | Binding Site |  | 
                    
                        | Calcium Binding |  | 
                    
                        | catalytic Activity |  | 
                    
                        | DNA Binding |  | 
                    
                        | EC Number |  | 
                    
                        | Enzyme Function | FUNCTION: Component of the SOS system and an inhibitor of cell division. Accumulation of SulA causes rapid cessation of cell division and the appearance of long, non-septate filaments. In the presence of GTP, binds a polymerization-competent form of FtsZ in a 1:1 ratio, thus inhibiting FtsZ polymerization and therefore preventing it from participating in the assembly of the Z ring. This mechanism prevents the premature segregation of damaged DNA to daughter cells during cell division. {ECO:0000255|HAMAP-Rule:MF_01179}. | 
                    
                        | Temperature Dependency |  | 
                    
                        | PH Dependency |  | 
                    
                        | Pathway |  | 
                    
                        | nucleotide Binding |  | 
                    
                        | Features | Chain (1); Region (2); Site (1) | 
                    
                        | Keywords | Cell cycle;Cell division;DNA damage;SOS response;Septation | 
                    
                        | Interact With |  | 
                    
                        | Induction | INDUCTION: By DNA damage, as part of the SOS response. {ECO:0000255|HAMAP-Rule:MF_01179}. | 
                    
                        | Subcellular Location |  | 
                    
                        | Modified Residue |  | 
                    
                        | Post Translational Modification | PTM: Is rapidly cleaved and degraded by the Lon protease once DNA damage is repaired. {ECO:0000255|HAMAP-Rule:MF_01179}. | 
                    
                        | Signal Peptide |  | 
                    
                        | Structure 3D |  | 
                    
                        | Cross Reference PDB | - | 
                    
                        | Mapped Pubmed ID | - | 
                    
                        | Motif |  | 
                    
                        | Gene Encoded By |  | 
                    
                        | Mass | 19,116 | 
                    
                        | Kinetics |  | 
                    
                        | Metal Binding |  | 
                    
                        | Rhea ID |  | 
                    
                        | Cross Reference Brenda |  |