| IED ID | IndEnz0002010032 | 
| Enzyme Type ID | protease010032 | 
| Protein Name | Turmerin Fragments | 
| Gene Name | |
| Organism | Curcuma longa (Turmeric) (Curcuma domestica) | 
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Zingiberales Zingiberaceae Curcuma Curcuma longa (Turmeric) (Curcuma domestica) | 
| Enzyme Sequence | LCPLDVLQLSSELLDIDGNEVEASRILSDITAFGGIRCPLTVVQSRGIGTIISSPYRFIAEGHPLSLKDMDGWFRVSDDEFNNYK | 
| Enzyme Length | 85 | 
| Uniprot Accession Number | P85278 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibition of trypsin (By similarity). Has anticarcinogenic activity, prevents transformation of DMBA-treated JB6 cells. Has antipromoter activity, prevents promotion by tetradecanoyl phorbal acetate (TPA) in JB6 cells. Prevents tertiary butyl hydroperoxide-induced mutagenesis. Protects AT base pairs and shows antimutagenesis activity in TA102 and TA104 S.typhimurium mutagenesis tests. Inhibits paw edema formation induced by phospholipase A2 in Swiss Wistar mice. Prevents the release of arachidonate, the parent compound for the synthesis of prostaglandins and prostacyclins. Has antimalarial activity, kills P.falciparum. Has antivenom activity, nullifies the lethal effects of N.naja venom and inhibits phospholipase A2 present in N.naja venom. Has antifungal activity, inhibits cilia formation by A.niger. Is not toxic or allergenic. {ECO:0000250|UniProtKB:P01070, ECO:0000269|PubMed:1731625, ECO:0000269|PubMed:18177267, ECO:0000269|Ref.1}. | 
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Stable for 7 days at room temperature and for 30 days at 4 degrees Celsius. Remains active after incubation at 100 degrees Celsius for 3 hours. {ECO:0000269|PubMed:1731625}; | 
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-adjacent residues (6); Non-terminal residue (2); Sequence uncertainty (9); Site (1) | 
| Keywords | Antimicrobial;Antioxidant;Direct protein sequencing;Fungicide;Protease inhibitor;Serine protease inhibitor | 
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: The N-terminus is blocked. {ECO:0000269|PubMed:1731625}. | 
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 9,417 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |