| IED ID | IndEnz0002010047 | 
| Enzyme Type ID | protease010047 | 
| Protein Name | Zinc metalloproteinase-disintegrin-like BaG EC 3.4.24.- Snake venom metalloproteinase SVMP Fragments | 
| Gene Name | |
| Organism | Bothrops alternatus (Urutu) (Rhinocerophis alternatus) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Bothrops Bothrops alternatus (Urutu) (Rhinocerophis alternatus) | 
| Enzyme Sequence | SISACNGLKGHFLIEPLKLSDSEKTDLLNRSHDNAQLSPINLVVAVIMAHEMGHGMVLPGTK | 
| Enzyme Length | 62 | 
| Uniprot Accession Number | P0C7B1 | 
| Absorption | |
| Active Site | ACT_SITE 51; /evidence="ECO:0000255|PROSITE-ProRule:PRU00276, ECO:0000255|PROSITE-ProRule:PRU10095" | 
| Activity Regulation | ACTIVITY REGULATION: Inhibited by EDTA, and 1,10-phenanthroline. {ECO:0000269|PubMed:12893294}. | 
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- | 
| Enzyme Function | FUNCTION: Snake venom Zinc metalloproteinase that inhibits ADP-induced platelet aggregation and inhibits the alpha-5/beta-1 (ITGA5/ITGB1) integrin, a fibronectin receptor. Has caseinolytic activity. Induces the detachment of cells that are bound to fibronectin. {ECO:0000269|PubMed:12893294}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Domain (1); Glycosylation (1); Metal binding (2); Non-adjacent residues (4); Non-terminal residue (2) | 
| Keywords | Cell adhesion impairing toxin;Direct protein sequencing;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Metal-binding;Metalloprotease;Platelet aggregation inhibiting toxin;Protease;Secreted;Toxin;Zinc | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:12893294}. | 
| Modified Residue | |
| Post Translational Modification | PTM: The N-terminus is blocked. | 
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 6,650 | 
| Kinetics | |
| Metal Binding | METAL 50; /note=Zinc; catalytic; /evidence=ECO:0000250; METAL 54; /note=Zinc; catalytic; /evidence=ECO:0000250 | 
| Rhea ID | |
| Cross Reference Brenda |