Detail Information for IndEnz0002010050
IED ID IndEnz0002010050
Enzyme Type ID protease010050
Protein Name PI-stichotoxin-Hcr2f
PI-SHTX-Hcr2f
Kunitz-type serine protease inhibitor HCRG1
Gene Name
Organism Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Heteractis Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus)
Enzyme Sequence RGICSEPKVVGPCKAGLRRFYYDSETGECKPFIYGGCKGNKNNFETLHACRGICRA
Enzyme Length 56
Uniprot Accession Number C0HJU6
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Dual-function toxin that inhibits both serine proteases and voltage-gated potassium channels (PubMed:26404319, PubMed:33158163). Has potent activity on both trypsin (Ki=28 nM) and chymotrypsin (Kd=1.8 nM) (PubMed:26404319). Shows inhibitory activity against 4 of the 7 potassium channels tested (rKv1.1/KCNA1; IC(50)=142.6 nM, hKv1.3/KCNA3; IC(50)=40.7 nM, rKv1.6/KCNA6; IC(50)=154.9 nM and drosophila Shaker; IC(50)=433.1 nM) (PubMed:33158163). Has an anti-inflammatory effect in LPS-activated macrophages in vitro, specifically reducing release of TNF and IL6 but not nitric oxide and reducing expression of IL1B precursor (PubMed:26404319). In contrast to some paralogs, this protein decreases reactive oxygen species (ROS) level in the oxidative stress agent 6-hydroxydopamine (6-OHDA)-induced neurotoxicity model, but does not show cytoprotective activity on neuroblastoma cells (PubMed:33802055). This protein also shows a weak free-radical scavenging activity (PubMed:33802055). In vivo, when tested in a mice model of acute local inflammation, it reduces paw edema during 24 hours. In addition, it also reduces the synthesis of TNF in this model (PubMed:33158163). {ECO:0000269|PubMed:26404319, ECO:0000269|PubMed:33158163}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Disulfide bond (3); Domain (1); Site (1)
Keywords Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Nematocyst;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin;Voltage-gated potassium channel impairing toxin
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:26404319}. Nematocyst {ECO:0000269|PubMed:26404319}.
Modified Residue
Post Translational Modification PTM: Contains 3 disulfide bonds. {ECO:0000269|PubMed:26404319}.
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 6,202
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda