| IED ID | IndEnz0002010070 | 
| Enzyme Type ID | protease010070 | 
| Protein Name | Tissue factor pathway inhibitor TFPI Extrinsic pathway inhibitor EPI Lipoprotein-associated coagulation inhibitor LACI | 
| Gene Name | TFPI | 
| Organism | Oryctolagus cuniculus (Rabbit) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Lagomorpha Leporidae (rabbits and hares) Oryctolagus Oryctolagus cuniculus (Rabbit) | 
| Enzyme Sequence | MKKEHIFWTSICLLLGLVPAPVSSAAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT | 
| Enzyme Length | 300 | 
| Uniprot Accession Number | P19761 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (9); Domain (3); Glycosylation (3); Sequence conflict (2); Signal peptide (1); Site (3) | 
| Keywords | Blood coagulation;Disulfide bond;Glycoprotein;Hemostasis;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor;Signal | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24 | 
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | 20193184; | 
| Motif | |
| Gene Encoded By | |
| Mass | 34,436 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |