IED ID | IndEnz0002010071 |
Enzyme Type ID | protease010071 |
Protein Name |
Ubiquitin carboxyl-terminal hydrolase 33 EC 3.4.19.12 Deubiquitinating enzyme 33 Ubiquitin thioesterase 33 Ubiquitin-specific-processing protease 33 |
Gene Name | usp33 ch211-284g18.1 |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Danionidae Danioninae Danio Danio rerio (Zebrafish) (Brachydanio rerio) |
Enzyme Sequence | MSGVSSNDCPHLECVGEITKEELIQKSHGQCQDCKVGGPNLWACLENGCSYVGCGESHADHSTVHSQETRHNLTVNLTTLRVWCYACTKEVFLERKLGPHKQLPNAAKAVSPVQTPCQDLNTPGSPTSLRVPSAGTCDDLDMETEEEDELRTRGLTGLKNIGNTCYMNAALQALSNCPPLTQFFLECGGLVKTDKKPALCKSYQKLITDLWHKNRNAYVVPTNLFQGIKAVNPMFRGYSQQDSQEFLRCLMDQLHEELKELIPEPEDPNQAVAMDDSPDEDNHSQSDDFQSCESCGSSDRADNEGPRVPEDINEAEMLMPEQNQNNRDWQKEKNLINNLYRAGSHGDLDKDVDTTSDSRPIISSQGAIKAQGRTSDSEIQVSSTVRPQSPTGNEGITSRLSSSPPKSSAWPNLSSTHKKVPMFTPTKTKRQRKYHSIISEVFDGTIVSSVQCLTCDRVSVTLENFQDISLPIPGKEDLAKLHSSSHQTALVKAGSCGEAYAPQGWIAFVMEYIKSWFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQSLPEILCIHLKRFRHELMFSTKIGTHVSFPLEGLEMQPFLAKDSSALTTTYDLLSVICHHGTASSGHYIAYCRNELNQLWYEFDDQSVTEVSESCVQNAEAYVLFYKKSNDETQKERRKVTSLFNMMEPSLLQFYVSRQWLNKFKTFAEPGPISNHDFLCAHGGIPPNKAAYIDDLVLMIPQNVWDHLYSRYGGGPAVNHLYVCHTCQNEIEKLEKRRKNELDMFVRLNKAFQEEESPVVIYCISMQWFREWESFVKGKDIDPPGPIDNSKIAVNKNGHITLKPGADSGQISEETWNFLHNIHGGGPVVTVRPSVSHQESETSQSEEKIEVETRTV |
Enzyme Length | 897 |
Uniprot Accession Number | A5PMR2 |
Absorption | |
Active Site | ACT_SITE 165; /note="Nucleophile"; /evidence="ECO:0000255|PROSITE-ProRule:PRU10092, ECO:0000255|PROSITE-ProRule:PRU10093"; ACT_SITE 628; /note="Proton acceptor"; /evidence="ECO:0000255|PROSITE-ProRule:PRU10092, ECO:0000255|PROSITE-ProRule:PRU10093" |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; |
DNA Binding | |
EC Number | 3.4.19.12 |
Enzyme Function | FUNCTION: Deubiquitinating enzyme involved in various processes such as centrosome duplication, cellular migration and beta-2 adrenergic receptor/ADRB2 recycling. Involved in regulation of centrosome duplication by mediating deubiquitination of ccp110 in S and G2/M phase, leading to stabilize ccp110 during the period which centrioles duplicate and elongate. Involved in cell migration via its interaction with intracellular domain of robo1, leading to regulate the Slit signaling. Plays a role in commissural axon guidance cross the ventral midline of the neural tube in a Slit-dependent manner, possibly by mediating the deubiquitination of robo1. Acts as a regulator of G-protein coupled receptor (GPCR) signaling by mediating the deubiquitination of beta-arrestins (arrb1 and arrb2) and beta-2 adrenergic receptor (adrb2). Deubiquitinates dio2, thereby regulating thyroid hormone regulation. Mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (2); Chain (1); Compositional bias (2); Domain (3); Metal binding (12); Region (3); Sequence conflict (3); Zinc finger (1) |
Keywords | Cytoplasm;Cytoskeleton;Endocytosis;Hydrolase;Metal-binding;Protease;Reference proteome;Repeat;Thiol protease;Ubl conjugation pathway;Zinc;Zinc-finger |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q8TEY7}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250|UniProtKB:Q8TEY7}. Note=Associates with centrosomes predominantly in S and G2 phases but less in G1 phase (By similarity). {ECO:0000250|UniProtKB:Q8TEY7}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 20040115; |
Motif | |
Gene Encoded By | |
Mass | 100,655 |
Kinetics | |
Metal Binding | METAL 9; /note=Zinc 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 11; /note=Zinc 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 31; /note=Zinc 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 34; /note=Zinc 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 44; /note=Zinc 3; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 49; /note=Zinc 3; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 54; /note=Zinc 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 61; /note=Zinc 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 65; /note=Zinc 3; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 71; /note=Zinc 3; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 84; /note=Zinc 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502; METAL 87; /note=Zinc 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00502 |
Rhea ID | |
Cross Reference Brenda |