| IED ID | IndEnz0002010139 |
| Enzyme Type ID | protease010139 |
| Protein Name |
Senescence-specific cysteine protease SAG12 EC 3.4.22.- Cysteine proteinase SAG12 Protein SENESCENCE-ASSOCIATED GENE 12 |
| Gene Name | SAG12 At5g45890 K15I22.9 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MALKHMQIFLFVAIFSSFCFSITLSRPLDNELIMQKRHIEWMTKHGRVYADVKEENNRYVVFKNNVERIEHLNSIPAGRTFKLAVNQFADLTNDEFRSMYTGFKGVSALSSQSQTKMSPFRYQNVSSGALPVSVDWRKKGAVTPIKNQGSCGCCWAFSAVAAIEGATQIKKGKLISLSEQQLVDCDTNDFGCEGGLMDTAFEHIKATGGLTTESNYPYKGEDATCNSKKTNPKATSITGYEDVPVNDEQALMKAVAHQPVSVGIEGGGFDFQFYSSGVFTGECTTYLDHAVTAIGYGESTNGSKYWIIKNSWGTKWGESGYMRIQKDVKDKQGLCGLAMKASYPTI |
| Enzyme Length | 346 |
| Uniprot Accession Number | Q9FJ47 |
| Absorption | |
| Active Site | ACT_SITE 154; /evidence=ECO:0000255|PROSITE-ProRule:PRU10088; ACT_SITE 289; /evidence=ECO:0000255|PROSITE-ProRule:PRU10089; ACT_SITE 310; /evidence=ECO:0000255|PROSITE-ProRule:PRU10090 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response. {ECO:0000305|PubMed:10380810, ECO:0000305|PubMed:10579486, ECO:0000305|PubMed:18212027, ECO:0000305|PubMed:18721318, ECO:0000305|PubMed:19143996, ECO:0000305|PubMed:19261736}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Glycosylation (2); Sequence conflict (2); Signal peptide (1) |
| Keywords | Apoptosis;Glycoprotein;Hydrolase;Hypersensitive response;Plant defense;Protease;Reference proteome;Signal;Thiol protease;Vacuole |
| Interact With | |
| Induction | INDUCTION: Expression activated by developmentally controlled senescence pathways leading to programmed cell death (PCD), probably by epigenetic regulation via histone H3 deacetylation and by WRKY53 activation (PubMed:10579486, PubMed:10380810, PubMed:18212027, PubMed:18721318, PubMed:19143996). Strongly up-regulated upon abscisic acid treatment (PubMed:9617813). Repressed by cytokinin, auxin (IAA), and sugars (sucrose, glucose and fructose) which can thus repress developmental senescence (PubMed:10579486). The senescence-associated accumulation is salicylic acid- (SA) dependent (PubMed:10972893). Induced slightly in outer leaves by UV-B exposure (PubMed:11432956). Expressed in late stages of heavy-metal- (e.g. copper) and hypersensitive response- (HR) mediated lesions, in chlorotic tissues surrounding the necrosis (PubMed:10380810). The induction by cadmium is nitric oxyde- (NO) dependent and occurs one day before cell death (PubMed:19261736). {ECO:0000269|PubMed:10380810, ECO:0000269|PubMed:10579486, ECO:0000269|PubMed:10972893, ECO:0000269|PubMed:11432956, ECO:0000269|PubMed:18212027, ECO:0000269|PubMed:18721318, ECO:0000269|PubMed:19143996, ECO:0000269|PubMed:19261736, ECO:0000269|PubMed:9617813}. |
| Subcellular Location | SUBCELLULAR LOCATION: Vacuole {ECO:0000269|PubMed:15743448}. Note=Localized in senescence-associated vacuoles (SAVs) with intense proteolytic activity that develop in the peripheral cytoplasm of mesophyll and guard cells. {ECO:0000269|PubMed:15743448}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10444084; 10579487; 11506370; 11598225; 12000449; 15165184; 15734912; 15797940; 16126861; 16244149; 16514542; 16883480; 17298883; 18452589; 18539778; 19453434; 19773385; 19857612; 20238146; 20439547; 20505355; 21489094; 21798944; 22080599; 22427974; 22706448; 23162120; 23207761; 23551974; 23629833; 23800962; 23922267; 23938390; 23959884; 24576761; 25242621; 25324183; 26031939; 26304848; 26896850; 26925086; 27135347; 27242830; 27581936; 28166280; 28351989; 28412544; 28510790; 28735023; 29982633; 30013580; 30120651; 30687379; 30712008; 31659127; 33283140; |
| Motif | |
| Gene Encoded By | |
| Mass | 38,234 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |